PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 274aa    MW: 30891.1 Da    PI: 9.6552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1385genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed ll+++v+ +G g+W++ +++ g+ R++k+c++rw +yl
      Gh_D08G1385 14 RGPWTPREDTLLINYVQTHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.55.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +t+Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w++yl
      Gh_D08G1385  67 RGNISTDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 112
                      7899******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.737961IPR017930Myb domain
SuperFamilySSF466892.71E-3011108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002498.2E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231568IPR009057Homeodomain-like
CDDcd001674.40E-111661No hitNo description
PROSITE profilePS5129425.84362116IPR017930Myb domain
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2569116IPR009057Homeodomain-like
CDDcd001671.34E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRAPCCTKV GLHRGPWTPR EDTLLINYVQ THGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI STDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT YLSKRLLSQG  120
IDPNTHKKLP KPVVQQVSKR KNSRGSNNKQ NPKKAKTTLE PAVIPKVHLP KPSKATSIYF  180
PRNDSFDQCN TFSTVCSSQG EEGIGTQVIQ GPWSEYVSHG ENGTGFLSES GCHPRVPSSE  240
GDNSLEKLYE EYLQLLKANE DQLQLDAFAE SLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475066.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2R5500.0A0A0D2R550_G
STRINGPOPTR_0014s09630.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.16e-71myb domain protein 3